Biotinylated BCMA Fc&Avi Tag Protein, Human
SKU: 13699771146

Biotinylated BCMA Fc&Avi Tag Protein, Human

Sale price$230.40 Regular price$256.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 6 - Jul 11

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated BCMA Fc&Avi Tag Protein, HumanProduct Specification Species Human Antigen BCMA Synonyms TNFRSF17, CD269, BCM, BCMA Accession Q02223 1 Amino Acid Sequence Met1 Ala54, with C terminal Human IgG1 Fc &Avi tag

Product Specification


Species Human
Antigen BCMA
Synonyms TNFRSF17, CD269, BCM, BCMA
Accession Q02223-1
Amino Acid Sequence

Met1-Ala54, with C-terminal Human IgG1 Fc &Avi tag

MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE


Expression System HEK293
Molecular Weight

38-45kDa (Reducing)

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Human Fc Tag, Avi Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Nina Shah, Ajai Chari, Emma Scott, Khalid Mezzi& Saad Z. Usmani: B-cell maturation antigen (BCMA) in multiple myeloma:rationale for targeting and current therapeutic approaches, Leukemia volume 34, pages985–1005 (2020).


Background

BCMA (The B-cell maturation antigen), also designated as TNFRSF17, belongs to the tumor necrosis factor receptor superfamily, which is a family of cytokine receptors. BCMA is encoded by a 2.92-kb TNFRSF17 gene located on the short arm of chromosome 16 (16p13.13) and composed of 3 exons separated by 2 introns. There are four natural splice variants of human BCMA that present with different receptor binding affinities, membrane-anchoring ability, and intracellular domain signaling. BCMA main ligands are the cytokines B-cell activating factor and a proliferation-inducing ligand. The interaction between BCMA and its ligands activates the NF-κB signaling pathway that plays an important role in B-cell proliferation and maturation and is essential for the survival of long-lived bone marrow plasma cells. BCMA is expressed preferentially on mature B cells and has minimal expression on hematopoietic stem cells or other cell types. The BCMA has emerged as a central target in multiple myeloma (MM). In preclinical studies, overexpression of BCMA and the interaction with is ligand, a proliferation-inducing ligand (APRIL), was found to promote MM progression in vivo and augment MM cell growth and survival through induction of multiple signaling cascades, including protein kinase B (AKT), MAPK, and nuclear factor (NF)-κB. Additionally, BCMA has been shown to be solubilized at high levels in serum of patients with MM (sBCMA). This form of sBCMA binds to B-cell activating factor (BAFF). The role of BAFF is to stimulate normal B-cell and plasma cell development; however, this functioning is prevented when it is bound by BCMA in the serum, thereby leading to decreased polyclonal immunoglobulin levels in patients with MM.


Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 13699771146

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 954 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Corbin
Cuba, US
★★★★★ 5
An Actual Nice Chair for a Decent Price. +2 for the Tool.
Color: Black Grey
Welp, My old chair finally broke, so It was time for a new one. I ended up coming across this chair here, and I couldn't really find anyone talking about it online. I decided to give it a shot since it was on a good sale for Christmas, going down to 99$. I'm going to be honest, I am pleasantly surprised. The cushioning for it is a little firm, but that is perfect for me. Its pretty average when it comes to office chairs, but having the added lower back support is a great touch. I have no complaints about it. The one thing that I am actually really happy about isn't on the chair. Don't get me wrong, over the week I have been using it, It has been nothing but great. That thing is the actual tool it came with. Its a basic Allen key, but the top of it is a molded handle instead of a "L" piece of metal. It made the already easy process of putting together this chair even better. Even after this chair has ran its course like all other chairs, I'm going to still use this tool. So yeah, I think 5 - stars pretty accurately describes how I feel about my chair.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 2, 2026
D
Verified Purchase
DEVON
Belleville, US
★★★★★ 5
COMFY CHAIR GOOD SUPPORT
Color: Dark Brown
So I needed an office chair because the one that I had wasn't really helping my back any. And it just didn't have enough cushion on the chair because when you want to sit for hours at your desk you want to be comfortable. So I took a chance on buying this chair. I thought the color was good and the price was right but I was still a little nervous because it said put together. So I got it right away only took 3 days. And the directions for pretty easy there were a couple of spots that I think we're out of order because you had to kind of play around with the screws going into the holes from the arms but I think if I were to get another chair like this I would probably do it my way because it's pretty self-explanatory but I followed the directions that came with the chair. And hey I'm 65 years old and I put this chair together. It's nice it's sleek and oh my God is it comfortable!!! Right where my lower back and sciatic is I get the support and it just feels good and I know that if I have to be at my desk for 3 or 4 hours I'm going to be comfortable. I highly highly recommend getting this chair. The only issue that I had was the driver did not leave it on my porch. I had ordered a Vizio TV a couple months ago and the driver brought it up to my porch. So I just had to go out and take two steps bring it into the house I really appreciated that. This driver didn't even come through the gate and there is no signs of any dogs because there aren't any. So this driver just left this giant heavy box it was about 35 lb in front of the garage where it was very visible from the road. And I had a dragon to my front door it was heavy I did not like that at all. But it wasn't damaged or anything and I do love the chair. I just don't like what the driver did.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 3, 2025
A
Verified Purchase
Aya
San Leandro, US
★★★★★ 5
Great sturdy chair and beautiful color
Color: White
I love this chair. I bought it for my home office. It is beautiful, sturdy and very comfortable. I'm not good at all with assembling even basic things but I would say that this was relatively pretty simple for someone like me to put together. Good price and good product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 3, 2026
O
Verified Purchase
OKCity
Natrona Heights, US
★★★★★ 4
Reliable, Comfortable, and Good-Looking Chair — I Keep Coming Back to It
Color: White
This is my fourth time purchasing this Amazon Basics mid-back office chair, which says a lot about its overall value. It looks clean and modern, fits well in a home office, and is genuinely comfortable for daily use. I typically get about a year and a half out of each one, which feels reasonable given the price point and materials. Out of the box, the chair is easy to assemble and immediately comfortable. The padding is supportive, the armrests are well positioned, and the faux leather gives it a more upscale appearance than many chairs in this category. It rolls smoothly, swivels easily, and works well for long computer sessions without causing back or shoulder fatigue. That said, this is not a lifetime chair. After extended use, the cushioning and structure do begin to wear, and that’s usually when I replace it. Still, considering the comfort, appearance, and cost, it remains one of the best value office chairs I’ve found — which is why I keep buying it again. Pros: • Comfortable padding and good mid-back support • Clean, modern appearance that looks great in an office • Smooth rolling and stable base • Easy assembly • Excellent value for the price Cons: • Durability is moderate; expect replacement after about 1½ years • Not designed for long-term heavy-duty use Verdict: If you want a comfortable, attractive, and affordable office chair that performs well for daily use, this is a strong choice. It may not last forever, but its comfort and value make it easy to recommend — and easy to repurchase.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 18, 2026
D
Verified Purchase
Debbie Segrest
Omaha, US
★★★★★ 5
Highly recommend
Color: Black
Very sturdy, the cushions make it super comfortable. The size and ease of movement are perfect. Assembly was super easy. A very quiet chair. Wonderful all around value.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 28, 2026

recommand products