CD3 delta His Tag Protein, Human
SKU: 39686759212

CD3 delta His Tag Protein, Human

Sale price$252.00 Regular price$280.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 5 - Jul 10

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD3 delta His Tag Protein, HumanProduct Specification Species Human Synonyms T3D, CD3 DELTA, CD3D Accession P04234 Amino Acid Sequence Phe22 Ala105, with C terminal 8*His FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAHHHHHHHH Expression System HEK293 Molecular Weight 17 30kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4 Reconstitution

Product Specification


Species Human
Synonyms T3D, CD3-DELTA, CD3D
Accession P04234
Amino Acid Sequence

Phe22-Ala105, with C-terminal 8*His

FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAHHHHHHHH

Expression System HEK293
Molecular Weight 17-30kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1mg/mL according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

T-cell surface glycoprotein CD3 delta chain, also known as CD3D, is a single-pass type I membrane protein. CD3 delta/CD3d is part of the T-cell receptor/CD3 complex (TCR/CD3 complex) and is involved in T-cell development and signal transduction. The encoded membrane protein represents the delta subunit of the CD3 complex, and along with four other CD3 subunits, binds either TCR alpha/beta or TCR gamma/delta to form the TCR/CD3 complex on the surface of T cells. CD3 delta/CD3d contains an 84 amino acid extracellular domain, a 21 amino acid transmembrane domain, and a 45 amino acid cytoplasmic domain. Deleterious mutation of the CD3 delta encoding gene in the human leads to a severe combined immunodeficiency characterised by the complete absence of mature T cell subpopulations including TCR alpha/beta and TCR gamma/delta. In humans the absence of CD3 delta results in a complete arrest in thymocyte development at the stage of double negative to double positive transition and the development of gamma delta T-cell receptor-positive T cells is also impaired. CD3D, together with CD3 epsilon (CD3E), CD3 gamma and CD3 zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T cell receptor-CD3 complex. T cell receptor-CD3 complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 39686759212

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 761 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
CG
Cuba, US
★★★★★ 5
Best book on the subject
Format: Paperback
Short yet concise argument for ending wars.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 31, 2022
H
Verified Purchase
harel charnis
Lowell, US
★★★★★ 5
A must learn
Format: Paperback
Too important to be forgitten
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 14, 2019
J
John Matlock
Lowell, US
★★★★★ 5
It's How Wars End That Become Important Afterward
Format: Paperback
The twentiety century taught us a lot about wars and how they end. World War I showed us that making strong demands on the defeated (who didn't admit defeat to their own people) set the stage for the next big war. World War II was fought until the Unconditional Surrender of the Germans and Japanese. Something that thinkers still debate as having made them fight all that harder. VietNam was fought with no clear end in sight, and "another VietNam" entered our language. The first Gulf War was ended when Colin Powell and Bush II debated how to end the war. They stopped before they had to go in and see what the Sunni's, Shiite's and Kurds made of the power vacuum left by the removal of Saddam would have created. Bush II is learning about this now. This is the second revised edition of this book, originally published in 1971 and then updated in 1991 and now 2005 to reflect happenings in new wars. Still some of the old wars had interesting insights that I didn't know before, such as how Finland, originally on Germany's side against Russia, made a peace with Russia and kicked the Germans out before they became a Russian province. Great Book.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2005
C
César González Rouco
Louisville, US
★★★★★ 3
Complementary readings
Format: Paperback
There are already three good reviews so I will only suggest reading the following books instead of, or in addition to, this peculiar work: a) "War in human civilization" by Azar Gat; b) "War before Civilization. The Myth of the Peaceful Savage", by Lawrence Keeley; c) "How War Began" by Keith F. Otterbein; d) "War and Peace and War: The Rise and Fall of Empires" by Peter Turchin; and e) "War and the Law of Nations: A General History" by Stephen Neff.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 8, 2009
B
bjcefola
Alexandria, US
★★★★★ 5
Excellent short-book analysis
Format: Paperback
This short book is an outstanding analysis of how nations end wars, or accept peace. Ikle shows how governments often prefer obviously self-destructive courses rather then compromise peace terms. The problem is most acute when factional interests dominate strategy rather then a rational unitary interest. In such a circumstance, factions that benefit from continuing the war will accuse those pursuing peace of treason. Sadly, there is no equivalent derogatory word in English for those who pursue war to the detriment of their country. The book was first written in 1971, and most of the examples are from the two world wars. The work is still extremely relevant, and at 130 pages it's well worth the time. Highly recommended as a first book to read on ending war.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2007

recommand products